HPA045382

antibody from Atlas Antibodies

Targeting: RSPH6A RSHL1, RSP4, RSP6, RSPH4B

Antibody data

Submit

Validation data

Product number: HPA045382 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA045382, RRID:AB_10959735
Product name: Anti-RSPH6A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LTTSLMLQRLQQGQSSLFQQLDPTFQEPPVNPLGQ FNLYQTDQFSEGAQHGPYIRDDPALQFLPSELGFP HYSAQVP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RSPH6A protein structure - HPA045382 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA045382 antibody. Corresponding RSPH6A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate positivity in spermatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
Sample type: HUMAN