HPA040586

antibody from Atlas Antibodies

Targeting: PLXNB1 KIAA0407, PLXN5, SEP

Antibody data

Submit

Validation data

Product number: HPA040586 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA040586, RRID:AB_10794034
Product name: Anti-PLXNB1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PGDNECVMELEGLEVVVEARVECEPPPDTQCHVTC QQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLH VVLYDCSVGHGDCSRCQTAMPQYGCVWC
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PLXNB1 protein structure - HPA040586 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using HPA040586 antibody. Corresponding PLXNB1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder shows moderate to strong cytoplasmic/ membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic/ membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and moderate membranous/ cytoplasmic positivity in cells in glomeruli.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Sample type: HUMAN