Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA043699 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA043699, RRID:AB_10960564
- Product name
- Anti-KHDC3L
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAG
TQQSLQAANKSGTQRSPEAASKAVTQRFREDARDP
VTRL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Report of four new patients with protein-truncating mutations in C6orf221/KHDC3L and colocalization with NLRP7.
Reddy R, Akoury E, Phuong Nguyen NM, Abdul-Rahman OA, Dery C, Gupta N, Daley WP, Ao A, Landolsi H, Ann Fisher R, Touitou I, Slim R
European journal of human genetics : EJHG 2013 Sep;21(9):957-64
European journal of human genetics : EJHG 2013 Sep;21(9):957-64
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.