Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001521 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001521, RRID:AB_1080705
- Product name
- Anti-ZNF350
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQ
SESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHD
IFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGD
SFLHANHERLHTAIKFPASQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The KRAB-containing zinc-finger transcriptional regulator ZBRK1 activates SCA2 gene transcription through direct interaction with its gene product, ataxin-2
Hallen L, Klein H, Stoschek C, Wehrmeyer S, Nonhoff U, Ralser M, Wilde J, Rohr C, Schweiger M, Zatloukal K, Vingron M, Lehrach H, Konthur Z, Krobitsch S
Human Molecular Genetics 2010 December;20(1):104-114
Human Molecular Genetics 2010 December;20(1):104-114
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
- Sample type
- HUMAN