Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036471 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036471, RRID:AB_10670799
- Product name
- Anti-SH3PXD2B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQL
KNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEE
KPDATPQNPFLKSRPQV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mutations in SH3PXD2B cause Borrone dermato-cardio-skeletal syndrome.
Wilson GR, Sunley J, Smith KR, Pope K, Bromhead CJ, Fitzpatrick E, Di Rocco M, van Steensel M, Coman DJ, Leventer RJ, Delatycki MB, Amor DJ, Bahlo M, Lockhart PJ
European journal of human genetics : EJHG 2014 Jun;22(6):741-7
European journal of human genetics : EJHG 2014 Jun;22(6):741-7
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SH3PXD2B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & plasma membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human soft tissue shows moderate cytoplasmic positivity in fibroblasts.
- Sample type
- HUMAN