HPA041449

antibody from Atlas Antibodies

Targeting: C6orf58 LEG1

Antibody data

Submit

Validation data

Product number: HPA041449 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041449, RRID:AB_2677486
Product name: Anti-C6orf58
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ISVDSWWADLNYFLSSLPFLAAVDSGVMGISSDQV RLLPPPKNERKFCYDVSSCRSSFPETMNKWNTFYQ YLQS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

C6orf58 protein structure - HPA041449 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and liver tissues using Anti-C6orf58 antibody. Corresponding C6orf58 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, duodenum and kidney using Anti-C6orf58 antibody HPA041449 (A) shows similar protein distribution across tissues to independent antibody HPA036263 (B).
Antibody #2 product nr: HPA036263
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-C6orf58 antibody HPA041449.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-C6orf58 antibody HPA041449.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-C6orf58 antibody HPA041449.
Sample type: HUMAN