Explore
Validate
LearnPAB23177
antibody from Abnova Corporation
Targeting: POGLUT1
9630046K23Rik, C3orf9, hCLP46, KDELCL1, KTELC1, MDS010, MDSRP, MGC32995, Rumi
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB23177 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB23177, RRID:AB_11121833
- Product name
- KTELC1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant KTELC1.
- Antigen sequence
VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDI
TCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKT
EL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with KTELC1 polyclonal antibody (Cat # PAB23177).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta with KTELC1 polyclonal antibody (Cat # PAB23177) shows moderate cytoplasmic positivity in trophoblastic cells at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
