Antibody data

Product number
PAB22782
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22782, RRID:AB_10963880
Product name
BCKDHB polyclonal antibody
Provider product page
Abnova Corporation - PAB22782
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant BCKDHB.
Antigen sequence
QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNS
LAKDPTAVIFGEDVAFGGVFRCTVGLRD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -