Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB27942 - Provider product page
- Provider
- Abnova Corporation
- Product name
- DENND1C polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant DENND1C.
- Antigen sequence
PLSPEDEGCPWAEEALDSSFLGSGEELDLLSEILD
SLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNI
PRWQPDDKKL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with DENND1C polyclonal antibody (Cat # PAB27942) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with DENND1C polyclonal antibody (Cat # PAB27942) at 1-4 ug/mL dilution shows positivity in plasma membrane and focal adhesions.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node with DENND1C polyclonal antibody (Cat # PAB27942) shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells at 1:2500-1:5000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)