PAB27998

CFAP54 antibody from Abnova Corporation
C12orf55, C12orf63, FLJ31514, FLJ44112
Immunocytochemistry
Data presented on provider website
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
PAB27998
Provider
Abnova Corporation
Product name
C12orf63 polyclonal antibody
Provider product page
Abnova Corporation - PAB27998
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human C12orf63
Reactivity
Human
Host
Rabbit
Antigen sequence
TRAHSILTEQMLAFGETIEFRSSNTKYANPLQPLK
NIYLPHVMLLAKIKMRIGHTVAKQVYYKNKRKDPS
KWLPALHLFDVALK
Isotype
IgG
Vial size
100 µL
Storage
Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.