HPA039897

CFAP54 antibody from Atlas Antibodies
C12orf55, C12orf63, FLJ31514, FLJ44112

Antibody data

Product number
HPA039897
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039897, RRID:AB_10674427
Product name
Anti-CFAP54
Provider product page
Atlas Antibodies - HPA039897
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQF
KATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDS
DENLKNKESVVQCLHILSSLRLIMQVA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.