Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00092935-M03 - Provider product page
- Provider
- Abnova Corporation
- Product name
- MARS2 monoclonal antibody (M03), clone 7C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MARS2.
- Antigen sequence
MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLS
AGDDACDVRAYFTTPIFYVNAAPHIGHLYSALLAD
ALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAAT
A- Isotype
- IgG
- Antibody clone number
- 7C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MARS2 monoclonal antibody (M03), clone 7C3. Western Blot analysis of MARS2 expression in MCF-7.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MARS2 expression in transfected 293T cell line by MARS2 monoclonal antibody (M03), clone 7C3.Lane 1: MARS2 transfected lysate (Predicted MW: 66.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MARS2 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol