Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA044124 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA044124, RRID:AB_10969197
- Product name
- Anti-CC2D2A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEV
SRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQV
YETVGHSSPTLLAEVFLPIPETTVVTGRAPTEEVE
FSSN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base.
Wang WJ, Tay HG, Soni R, Perumal GS, Goll MG, Macaluso FP, Asara JM, Amack JD, Tsou MF
Nature cell biology 2013 Jun;15(6):591-601
Nature cell biology 2013 Jun;15(6):591-601
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong positivity in ciliated cells.
- Sample type
- HUMAN