Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002550-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002550-M01, RRID:AB_464276
- Product name
- GABBR1 monoclonal antibody (M01), clone 2D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GABBR1.
- Antigen sequence
AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRR
DILPDYELKLIHHDSKCDPGQATKYLYELLYNDPI
KIILMPGCSSVSTLVAEAARMWNLIVLSYG- Isotype
- IgG
- Antibody clone number
- 2D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Limbic encephalitis due to GABAB and AMPA receptor antibodies: a case series.
Conjoint occurrence of GABAB receptor antibodies in Lambert-Eaton myasthenic syndrome with antibodies to the voltage gated calcium channel.
Cortical stimulation causes long-term changes in H-reflexes and spinal motoneuron GABA receptors.
Genome-wide association study reveals multiple nasopharyngeal carcinoma-associated loci within the HLA region at chromosome 6p21.3.
Dogan Onugoren M, Deuretzbacher D, Haensch CA, Hagedorn HJ, Halve S, Isenmann S, Kramme C, Lohner H, Melzer N, Monotti R, Presslauer S, Schäbitz WR, Steffanoni S, Stoeck K, Strittmatter M, Stögbauer F, Trinka E, von Oertzen TJ, Wiendl H, Woermann FG, Bien CG
Journal of neurology, neurosurgery, and psychiatry 2015 Sep;86(9):965-72
Journal of neurology, neurosurgery, and psychiatry 2015 Sep;86(9):965-72
Conjoint occurrence of GABAB receptor antibodies in Lambert-Eaton myasthenic syndrome with antibodies to the voltage gated calcium channel.
Dogan Onugoren M, Rauschka H, Bien CG
Journal of neuroimmunology 2014 Aug 15;273(1-2):115-6
Journal of neuroimmunology 2014 Aug 15;273(1-2):115-6
Cortical stimulation causes long-term changes in H-reflexes and spinal motoneuron GABA receptors.
Wang Y, Chen Y, Chen L, Wolpaw JR, Chen XY
Journal of neurophysiology 2012 Nov;108(10):2668-78
Journal of neurophysiology 2012 Nov;108(10):2668-78
Genome-wide association study reveals multiple nasopharyngeal carcinoma-associated loci within the HLA region at chromosome 6p21.3.
Tse KP, Su WH, Chang KP, Tsang NM, Yu CJ, Tang P, See LC, Hsueh C, Yang ML, Hao SP, Li HY, Wang MH, Liao LP, Chen LC, Lin SR, Jorgensen TJ, Chang YS, Shugart YY
American journal of human genetics 2009 Aug;85(2):194-203
American journal of human genetics 2009 Aug;85(2):194-203
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GABBR1 monoclonal antibody (M01), clone 2D7 Western Blot analysis of GABBR1 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GABBR1 expression in transfected 293T cell line by GABBR1 monoclonal antibody (M01), clone 2D7.Lane 1: GABBR1 transfected lysate(95 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GABBR1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to GABBR1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
