HPA041632

antibody from Atlas Antibodies

Targeting: HNRNPUL2 DKFZp762N1910, HNRPUL2

Antibody data

Submit

Validation data

Product number: HPA041632 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041632, RRID:AB_10960896
Product name: Anti-HNRNPUL2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LPGSGKTQWALKYAKENPEKRYNVLGAETVLNQMR MKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRT KRNFIL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HNRNPUL2 protein structure - HPA041632 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and pancreas tissues using HPA041632 antibody. Corresponding HNRNPUL2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.
Sample type: HUMAN