HPA038366

antibody from Atlas Antibodies

Targeting: NADK2 C5orf33, FLJ30596, MNADK, NADKD1

Antibody data

Submit

Validation data

Product number: HPA038366 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038366, RRID:AB_2675977
Product name: Anti-NADK2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RELVEKVTNEYNESLLYSPEEPKILFSIREPIANR VFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEF NDGAIASMMINKEDELRTVLLE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NADK2 protein structure - HPA038366 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and skeletal muscle tissues using Anti-NADK2 antibody. Corresponding NADK2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, lymph node and skeletal muscle using Anti-NADK2 antibody HPA038366 (A) shows similar protein distribution across tissues to independent antibody HPA038367 (B).
Antibody #2 product nr: HPA038367
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-NADK2 antibody HPA038366.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-NADK2 antibody HPA038366.
Sample type: HUMAN