Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406300 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Butyrophilin-Like 9 (BTNL9) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BTNL9 antibody: synthetic peptide directed towards the N terminal of human BTNL9
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTK
LVKDD IAYGSVVLQL- Vial size
- 50 µg
Submitted references The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A
Genome research 2003 Oct;13(10):2265-70
Genome research 2003 Oct;13(10):2265-70
No comments: Submit comment
No validations: Submit validation data