HPA045936

antibody from Atlas Antibodies

Targeting: SPESP1 SP-ESP

Antibody data

Submit

Validation data

Product number: HPA045936 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA045936, RRID:AB_2679504
Product name: Anti-SPESP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGR EKKSNSPKHVYSIASKGSKFKELVTHGDASTENDV LTNPISEETTTFPTG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SPESP1 protein structure - HPA045936 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and prostate tissues using Anti-SPESP1 antibody. Corresponding SPESP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, endometrium, lymph node and testis using Anti-SPESP1 antibody HPA045936 (A) shows similar protein distribution across tissues to independent antibody HPA051040 (B).
Antibody #2 product nr: HPA051040
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium using Anti-SPESP1 antibody HPA045936.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SPESP1 antibody HPA045936.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SPESP1 antibody HPA045936.
Sample type: HUMAN