HPA043761

antibody from Atlas Antibodies

Targeting: DPY30 Cps25, HDPY-30, Saf19

Antibody data

Submit

Validation data

Product number: HPA043761 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA043761, RRID:AB_10960501
Product name: Anti-DPY30
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRA YLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLK NKAQFEDRN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DPY30 protein structure - HPA043761 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and pancreas tissues using HPA043761 antibody. Corresponding DPY30 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate to strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows nuclear positivity.
Sample type: HUMAN