Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503862 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-NOTCH-Regulated Ankyrin Repeat Protein (NRARP) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NRARP antibody: synthetic peptide directed towards the middle region of human NRARP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKL
LVKFG ADIRLANRDG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA, Mammalian Gene Collection Program Team
Proceedings of the National Academy of Sciences of the United States of America 2002 Dec 24;99(26):16899-903
Proceedings of the National Academy of Sciences of the United States of America 2002 Dec 24;99(26):16899-903
No comments: Submit comment
No validations: Submit validation data