HPA038199

WDR75 antibody from Atlas Antibodies
FLJ12519, NET16, UTP17
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA038199
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038199, RRID:AB_10674548
Product name
Anti-WDR75
Provider product page
Atlas Antibodies - HPA038199
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HMDGKIRLWRNFYDDKKYTYTCLHWHHDMVMDLAF
SVTGTSLLSGGRESVLVEWRDATEKNKEFLPRLGA
TIEHISVSPAGDLFCTSHSDNKIII
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -