PAB23238

WDR75 antibody from Abnova Corporation
FLJ12519, NET16, UTP17

Antibody data

Product number
PAB23238
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23238, RRID:AB_11122237
Product name
WDR75 polyclonal antibody
Provider product page
Abnova Corporation - PAB23238
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant WDR75.
Antigen sequence
HMDGKIRLWRNFYDDKKYTYTCLHWHHDMVMDLAF
SVTGTSLLSGGRESVLVEWRDATEKNKEFLPRLGA
TIEHISVSPAGDLFCTSHSDNKIII
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -