Antibody data

Product number
H00008310-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008310-D01P, RRID:AB_10646077
Product name
ACOX3 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00008310-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human ACOX3 protein.
Antigen sequence
MASTVEGGDTALLPEFPRGPLDAYRARASFSWKEL
ALFTEGEGMLRFKKTIFSALENDPLFARSPGADLS
LEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPA
LIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERH
LTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAH
YDPATEEFIIHSPDFEAAKFWVGNMGKTATHAVVF
AKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGVMVG
DIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDV
TPEGTYVSPFKDVRQRFGASLGSLSSGRVSIVSLA
ILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYP
MQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLA
SGDRSARQAELGREIHALASASKPLASWTTQQGIQ
ECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNN
ILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLD
AYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYL
LRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLAL
AFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALY
ALWSLSRHAALLYRAERRCSCPGRRDRSS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -