HPA038340

antibody from Atlas Antibodies

Targeting: BUD13 Cwc26, fSAP71, MGC13125

Antibody data

Submit

Validation data

Product number: HPA038340 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038340, RRID:AB_2675967
Product name: Anti-BUD13
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWK ESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGD KKQLDSKGDCQKAT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BUD13 protein structure - HPA038340 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-BUD13 antibody HPA038340 (A) shows similar protein distribution across tissues to independent antibody HPA038341 (B).
Antibody #2 product nr: HPA038341
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows distinct nuclear positivity in cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-BUD13 antibody HPA038340.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-BUD13 antibody HPA038340.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-BUD13 antibody HPA038340.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-BUD13 antibody HPA038340.
Sample type: HUMAN