Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038161 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA038161, RRID:AB_10674547
- Product name
- Anti-CEP83
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDY
TRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPV
SFQSSAMVPSMELPFPPHMQEEQHQRELSL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Centrosome-intrinsic mechanisms modulate centrosome integrity during fever.
Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles.
Mutations of CEP83 cause infantile nephronophthisis and intellectual disability.
Vertii A, Zimmerman W, Ivshina M, Doxsey S
Molecular biology of the cell 2015 Oct 1;26(19):3451-63
Molecular biology of the cell 2015 Oct 1;26(19):3451-63
Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles.
Kong D, Farmer V, Shukla A, James J, Gruskin R, Kiriyama S, Loncarek J
The Journal of cell biology 2014 Sep 29;206(7):855-65
The Journal of cell biology 2014 Sep 29;206(7):855-65
Mutations of CEP83 cause infantile nephronophthisis and intellectual disability.
Failler M, Gee HY, Krug P, Joo K, Halbritter J, Belkacem L, Filhol E, Porath JD, Braun DA, Schueler M, Frigo A, Alibeu O, Masson C, Brochard K, Hurault de Ligny B, Novo R, Pietrement C, Kayserili H, Salomon R, Gubler MC, Otto EA, Antignac C, Kim J, Benmerah A, Hildebrandt F, Saunier S
American journal of human genetics 2014 Jun 5;94(6):905-14
American journal of human genetics 2014 Jun 5;94(6):905-14
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong nuclear positivity in renal tubules.
- Sample type
- HUMAN