Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA037909 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA037909, RRID:AB_10672731
- Product name
- Anti-IFT46
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEI
KELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDI
DAFLKVPRPDGKPDNLGLLV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Characterization of Tetratricopeptide Repeat-Containing Proteins Critical for Cilia Formation and Function
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Xu Y, Cao J, Huang S, Feng D, Zhang W, Zhu X, Yan X, Roy S
PLOS ONE 2015 April;10(4)
PLOS ONE 2015 April;10(4)
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bronchus shows moderate cytoplasmic and membrane positivity in respiratory epithelial cells.
- Sample type
- HUMAN