Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28741 - Provider product page
- Provider
- Abnova Corporation
- Product name
- HTR2C polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human HTR2C.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SSTSDSNTDQEETLQIKVLPPCIISGGNTAKSKEI
CGASLTLSTLMSSSGSNNNLSISNEEPTFSPIPVM
QTEILSPLRDHENLKNLWVKIDLDLLSRVPGHSSL
HAAPAKPDHKETATKPKRQTAVTAVEKPAPKGKRK
H- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251MG with HTR2C polyclonal antibody (Cat # PAB28741) at 1-4 ug/mL shows positivity in nucleus and plasma membrane.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas with HTR2C polyclonal antibody (Cat # PAB28741) shows strong cytoplasmic and membranous positivity in islet cells at 1:10-1:20 dilution.
- Validation comment
- Immunohistochemistry