HPA060391

BRK1 antibody from Atlas Antibodies
C3orf10, HSPC300, MDS027

Antibody data

Product number
HPA060391
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060391, RRID:AB_2684272
Product name
Anti-BRK1
Provider product page
Atlas Antibodies - HPA060391
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAGQEDPVQREIHQDWANREYIEIITSSIKKIADF
LNSFDMSCRSRLATLNEKLTALERRIEYIEARVT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -