Antibody data

Product number
PAB20494
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20494, RRID:AB_10966221
Product name
GAB3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20494
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GAB3.
Antigen sequence
CTLVPRRISLSGLDNMRTWKADVEGQSLRHRDKRL
SLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGL
GPHCSPDDYIPMNSGSISSPLPELPANLEPPPVNR
DLKPQRKSRPPPLDLRNLSIIREHASLTRTRTVPC
SRTSF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.