HPA025023

antibody from Atlas Antibodies

Targeting: KIF13B GAKIN, KIAA0639

Antibody data

Submit

Validation data

Product number: HPA025023 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA025023, RRID:AB_1852471
Product name: Anti-KIF13B
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGS NKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHS PDPGLSNLAASYLNP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

KIF13B protein structure - HPA025023 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human parathyroid gland and skeletal muscle tissues using Anti-KIF13B antibody. Corresponding KIF13B RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, lymph node, parathyroid gland and skeletal muscle using Anti-KIF13B antibody HPA025023 (A) shows similar protein distribution across tissues to independent antibody HPA049655 (B).
Antibody #2 product nr: HPA049655
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human parathyroid gland shows strong membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human parathyroid gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-KIF13B antibody HPA025023.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-KIF13B antibody HPA025023.
Sample type: HUMAN