HPA046644

DEGS2 antibody from Atlas Antibodies
C14orf66, DES2, FADS8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA046644
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046644, RRID:AB_2797231
Product name
Anti-DEGS2
Provider product page
Atlas Antibodies - HPA046644
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRV
YRLA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -