HPA045520

antibody from Atlas Antibodies

Targeting: SRL SAR

Antibody data

Submit

Validation data

Product number: HPA045520 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA045520, RRID:AB_2679358
Product name: Anti-SRL
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PDTHQELFLQEEISLLEDLNQVIENRLENKIAFIR QHAIRVRIHALLVDRYLQTYKDKMTFFSDGELVFK DIVEDPDKFYIFKTILAKTNVSK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SRL protein structure - HPA045520 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-SRL antibody. Corresponding SRL RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, heart muscle, prostate and skeletal muscle using Anti-SRL antibody HPA045520 (A) shows similar protein distribution across tissues to independent antibody HPA041535 (B).
Antibody #2 product nr: HPA041535
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SRL antibody HPA045520.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle using Anti-SRL antibody HPA045520.
Sample type: HUMAN