HPA044968

HMCES antibody from Atlas Antibodies
C3orf37, DC12, SRAPD1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA044968
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA044968, RRID:AB_2679160
Product name
Anti-HMCES
Provider product page
Atlas Antibodies - HPA044968
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKG
LSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKL
IHPTENITFHAVSSVVNNS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -