HPA049488

antibody from Atlas Antibodies

Targeting: GOLM2 CASC4, DKFZp459F1927, H63

Antibody data

Submit

Validation data

Product number: HPA049488 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA049488, RRID:AB_2680790
Product name: Anti-CASC4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPR IQTDILKQATKDRVSDFHKLKQSRFFDENESPVDP QHGSKLADYNGDDG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GOLM2 protein structure - HPA049488 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, lymph node and pancreas using Anti-CASC4 antibody HPA049488 (A) shows similar protein distribution across tissues to independent antibody HPA043015 (B).
Antibody #2 product nr: HPA043015
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CASC4 antibody HPA049488.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-CASC4 antibody HPA049488.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CASC4 antibody HPA049488.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CASC4 antibody HPA049488.
Sample type: HUMAN