Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [2]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000633-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000633-M01, RRID:AB_425325
- Product name
- BGN monoclonal antibody (M01), clone 4E1-1G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant BGN.
- Antigen sequence
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFM
MNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCH
LRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISEL
RKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKL
QKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVP
KGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKL
NYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIE
LEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLR
ELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKV
GVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPA
TFRCVTDRLAIQFGNYKK- Isotype
- IgG
- Antibody clone number
- 4E1-1G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The small leucine-rich proteoglycan BGN accumulates in CADASIL and binds to NOTCH3.
Zhang X, Lee SJ, Young MF, Wang MM
Translational stroke research 2015 Apr;6(2):148-55
Translational stroke research 2015 Apr;6(2):148-55
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BGN monoclonal antibody (M01), clone 4E1-1G7 Western Blot analysis of BGN expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BGN expression in transfected 293T cell line by BGN monoclonal antibody (M01), clone 4E1-1G7.Lane 1: BGN transfected lysate(41.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BGN is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BGN is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of BGN transfected lysate using anti-BGN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BGN MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to BGN on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol