HPA051000

antibody from Atlas Antibodies

Targeting: PPP1R18 KIAA1949, phostensin

Antibody data

Submit

Validation data

Product number: HPA051000 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA051000, RRID:AB_2681304
Product name: Anti-PPP1R18
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PKGRESREERLSPRETRERRLGIGGAQELSLRPLE ARDWRQSPGEVGDRSSRLSEAWKWRLSPGETPERS LRLAESREQSPRR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PPP1R18 protein structure - HPA051000 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-PPP1R18 antibody. Corresponding PPP1R18 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-PPP1R18 antibody HPA051000 (A) shows similar protein distribution across tissues to independent antibody HPA044745 (B).
Antibody #2 product nr: HPA044745
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-PPP1R18 antibody HPA051000.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PPP1R18 antibody HPA051000.
Sample type: HUMAN