HPA051624

NOM1 antibody from Atlas Antibodies
C7orf3, PPP1R113, SGD1

Antibody data

Product number
HPA051624
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051624, RRID:AB_2681556
Product name
Anti-NOM1
Provider product page
Atlas Antibodies - HPA051624
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSWDSVLSAEQTGRWWIVGSAWSGAPMIDNSHHTH
LQKQLVGTVSSKILELARKQRMNTDIRRNIFCTIM
TSEDFLDAFEKLLKLGLKDQQEREIIHVLMDCCLQ
EKTYNPFYAFLASKFCEYERRFQMTFQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.