HPA019866

NOM1 antibody from Atlas Antibodies
C7orf3, PPP1R113, SGD1

Antibody data

Product number
HPA019866
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019866, RRID:AB_2670300
Product name
Anti-NOM1
Provider product page
Atlas Antibodies - HPA019866
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ITDKSLCGSGEKYIPPHVRQAEETVDFKKKEELER
LKKHVKGLLNRLSEPNMASISGQLEELYMAHSRKD
MNDTLTSALMGACVTASAMPSRLMMEHVLLVSILH
HTVGIEVGAHFLEAVVRKFDAIYKYGSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.