HPA060454

antibody from Atlas Antibodies

Targeting: FKRP FKTR, LGMD2I, MDC1C

Antibody data

Submit

Validation data

Product number: HPA060454 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA060454, RRID:AB_2684281
Product name: Anti-FKRP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIP WDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFV WEKAVEGDF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

FKRP protein structure - HPA060454 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and pancreas tissues using HPA060454 antibody. Corresponding FKRP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in a subset of tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
Sample type: HUMAN