HPA059465

antibody from Atlas Antibodies

Targeting: RNASE12 RAI1

Antibody data

Submit

Validation data

Product number: HPA059465 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA059465, RRID:AB_2732638
Product name: Anti-RNASE12
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRV IREPDHTCKKEHVFIHERPR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RNASE12 protein structure - HPA059465 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human epididymis and fallopian tube tissues using Anti-RNASE12 antibody. Corresponding RNASE12 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, epididymis, kidney and liver using Anti-RNASE12 antibody HPA059465 (A) shows similar protein distribution across tissues to independent antibody HPA044175 (B).
Antibody #2 product nr: HPA044175
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-RNASE12 antibody HPA059465.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-RNASE12 antibody HPA059465.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-RNASE12 antibody HPA059465.
Sample type: HUMAN