R32279

antibody from NSJ Bioreagents

Targeting: SFTPA2 COLEC5, SP-A2

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

R32279

Provider

NSJ Bioreagents

Product name

SFTPA1/2 Antibody

Antibody type

Polyclonal

Antigen

Amino acids VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN of human SFTPA1/2 were used as the immunogen for the SFTPA1/2 antibody.

Description

Antigen affinity

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Vial size

100 µg

Concentration

Lyophilized; resuspend with 200 ul for 0.5 mg/ml

Storage

After reconstitution, the SFTPA1/2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Western blot

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

Western blot testing of 1) rat lung, 2) mouse lung, 3) A549 lysate with SFTPA1/2 antibody. Expected/observed molecular weight ~26 kDa.

Immunohistochemistry

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE human lung cancer with SFTPA1/2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE mouse lung with SFTPA1/2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE rat lung with SFTPA1/2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of frozen mouse lung with SFTPA1/2 antibody.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of frozen rat lung with SFTPA1/2 antibody.