Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20024 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20024, RRID:AB_10962591
- Product name
- ANGEL1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant ANGEL1.
- Antigen sequence
PLWPSSLGITDCCQYVTSCHPKRSERRKYGRDFLL
RFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAES
VLEEDASELEPAFSRTVGTIQHCLHLTSVYTHFLP
QRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTD
HRLYRDG- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with ANGEL1 polyclonal antibody (Cat # PAB20024).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas with ANGEL1 polyclonal antibody (Cat # PAB20024) shows cytoplasmic positivity in endocrine cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)