HPA074034

ADAM28 antibody from Atlas Antibodies
ADAM23, eMDCII, MDC-Lm, MDC-Ls

Antibody data

Product number
HPA074034
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA074034, RRID:AB_2686654
Product name
Anti-ADAM28
Provider product page
Atlas Antibodies - HPA074034
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFET
ELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNS
TGKEITTSPQIMDDCYY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -