HPA048531

antibody from Atlas Antibodies

Targeting: MTSS2 ABBA, ABBA-1, LOC92154, MTSS1L

Antibody data

Submit

Validation data

Product number: HPA048531 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA048531, RRID:AB_2680430
Product name: Anti-MTSS1L
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PTSDWSKVGSHEQPSGATLQRRKDRVELLRDTEPG PASGGTLGPSGEEAPRPRMSPATIAAKHGEEVSPA ASDLAMVLTRGLSLEHQKSSR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MTSS2 protein structure - HPA048531 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in glial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in glial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in glial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in glomeruli.
Sample type: HUMAN