WH0083259M2

PCDH11Y antibody from Sigma-Aldrich
PCDH22, PCDHY
ELISA
Recommended by provider

Antibody data

Product number
WH0083259M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0083259M2, RRID:AB_1842860
Product name
Monoclonal Anti-PCDH11Y antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0083259M2
Antibody type
Monoclonal
Antigen
PCDH11Y (AAH64550, a.a. 57-166) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTT
TMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE
KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLI
EDIN* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -