Explore
Validate
LearnH00010772-M03
antibody from Abnova Corporation
Targeting: SRSF10
FUSIP1, FUSIP2, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR1, TASR2
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010772-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010772-M03, RRID:AB_534874
- Product name
- FUSIP1 monoclonal antibody (M03), clone 1A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FUSIP1.
- Antigen sequence
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGP
IVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
LDRKWICGRQIEIQFAQGDRKTPNQMKAKE- Isotype
- IgG
- Antibody clone number
- 1A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FUSIP1 monoclonal antibody (M03), clone 1A6 Western Blot analysis of FUSIP1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FUSIP1 expression in transfected 293T cell line by FUSIP1 monoclonal antibody (M03), clone 1A6.Lane 1: FUSIP1 transfected lysate(22.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FUSIP1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to FUSIP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to FUSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
