AV54779

LGALS3BP antibody from Sigma-Aldrich
90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
No application information provided.

Antibody data

Product number
AV54779
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV54779, RRID:AB_1852826
Product name
Anti-LGALS3BP antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV54779
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human LGALS3BP with an internal ID of P31574
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFNLSLYWSHEALFQKKTLQALEFHTVPFQLLARY
KGLNLTEDTYKPRIY
Storage
-20C
Provider Type Product Number
- No reagents -