HPA042278

antibody from Atlas Antibodies

Targeting: MGA FLJ12634, KIAA0518, MAD5, MXD5

Antibody data

Submit

Validation data

Product number: HPA042278 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042278, RRID:AB_10794647
Product name: Anti-MGA
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFEL SGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKH LKGPLTRKCVGASQECKKEADEQLIKETKTCQENS DVFQQEQGISDLLGKSGITEDARVLKTECDSWSRI S
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MGA protein structure - HPA042278 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human endometrium and skeletal muscle tissues using HPA042278 antibody. Corresponding MGA RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human hippocampus shows nucleolar positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular and stromal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human uterine cervix shows weak to moderate nuclear positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN