HPA000278

antibody from Atlas Antibodies

Targeting: CKAP4 CLIMP-63, ERGIC-63, P63

Antibody data

Submit

Validation data

Product number: HPA000278 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA000278, RRID:AB_1078527
Product name: Anti-CKAP4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHE QRLAALQGRLEGLGSSEADQDGLASTVRSLGETQL VLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLS QDQAQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CKAP4 protein structure - HPA000278 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody HPA000278 (A) shows similar protein distribution across tissues to independent antibody HPA000792 (B).
Antibody #2 product nr: HPA000792
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow using Anti-CKAP4 antibody HPA000278.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CKAP4 antibody HPA000278.
Sample type: HUMAN