HPA068660

antibody from Atlas Antibodies

Targeting: CUZD1 ERG-1, UO-44

Antibody data

Submit

Validation data

Product number: HPA068660 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA068660, RRID:AB_2686015
Product name: Anti-CUZD1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: CKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTD SIIGPIRLKRDRSASGNSGFQHETHAEETPNQP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CUZD1 protein structure - HPA068660 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human pancreas and colon tissues using Anti-CUZD1 antibody. Corresponding CUZD1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, lymph node, pancreas and testis using Anti-CUZD1 antibody HPA068660 (A) shows similar protein distribution across tissues to independent antibody HPA068479 (B).
Antibody #2 product nr: HPA068479
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CUZD1 antibody HPA068660.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CUZD1 antibody HPA068660.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CUZD1 antibody HPA068660.
Sample type: HUMAN